|
|
|
|
|
|
|
| Information on 1ot8_A_97 |
|
Loop code: 1ot8_A_97 PDB: 1ot8 Chain: A Type: HH alpha-alpha |
Loop Start: 97 Loop Length: 16 Sec Struct Nt length: 8 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | MGVFQILLRNRATNLNARMHDGTTPLILAAR |
| Sec Struct: | HHHHHHHHT-TT--TT---TT---HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | M - 97 | 1 | 0 |
| MGMAGNESIUM ION | Q - 101 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|