|
|
|
|
|
|
|
| Information on 1p0h_A_163 |
|
Loop code: 1p0h_A_163 PDB: 1p0h Chain: A Type: HH alpha-alpha |
Loop Start: 163 Loop Length: 11 Sec Struct Nt length: 11 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | DAELLRVNNAAFAGHPEQGGWTAVQLAERR |
| Sec Struct: | HHHHHHHHHHHTTT-TTTSS--HHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACOACETYL COENZYME *A | A - 173 | 0 | 1 |
| COACOENZYME A | A - 173 | 0 | 1 |
| ACOACETYL COENZYME *A | F - 174 | 0 | 1 |
| COACOENZYME A | F - 174 | 0 | 1 |
| ACOACETYL COENZYME *A | H - 177 | 0 | 1 |
| COACOENZYME A | H - 177 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|