|
|
|
|
|
|
|
| Information on 1uq5_A_182 |
|
Loop code: 1uq5_A_182 PDB: 1uq5 Chain: A Type: HH alpha-alpha |
Loop Start: 182 Loop Length: 8 Sec Struct Nt length: 12 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | QYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQE |
| Sec Struct: | HHHHHHHHHHHHTT--B---HHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACTACETATE ION | M - 188 | 1 | 0 |
| ACTACETATE ION | R - 191 | 1 | 0 |
| ACTACETATE ION | I - 192 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC1ACT BINDING SITE FOR CHAIN A | I - 192 | 0 | 1 |
| Associated ArchDB95 Subclass to 1uq5_A_182 |
| For any comment or web-related incidence, send an email to the webmaster. |
|