|
|
|
|
|
|
|
| Information on 1ubl_L_400 |
|
Loop code: 1ubl_L_400 PDB: 1ubl Chain: L Type: HH alpha-alpha |
Loop Start: 400 Loop Length: 9 Sec Struct Nt length: 14 Sec Struct Ct length: 31 Structure geometry
|
| Sequence: | PKVKAVTDAVLAKLGVGPEALFSTLGRTAARGIETAVIAEYVGVMLQEYKDNIA |
| Sec Struct: | HHHHHHHHHHHHHHT--GGGGSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MPD2-METHYL-2,4-PENTANEDIOL | T - 406 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | D - 407 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | L - 410 | 1 | 0 |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 417 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | E - 418 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | L - 420 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | F - 421 | 0 | 1 |
| Associated ArchDB95 Subclass to 1ubl_L_400 |
| For any comment or web-related incidence, send an email to the webmaster. |
|