|
|
|
|
|
|
|
| Information on 1ek9_A_300 |
|
Loop code: 1ek9_A_300 PDB: 1ek9 Chain: A Type: HH alpha-alpha |
Loop Start: 300 Loop Length: 2 Sec Struct Nt length: 57 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | SQVKQAQYNFVGASEQLESAHRSVVQTVRSSFNNINASISSINAYKQAVVSAQSSLDAEAGYS |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | S - 300 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 301 | 1 | 0 |
| MSESELENOMETHIONINE | V - 302 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 304 | 1 | 0 |
| MSESELENOMETHIONINE | S - 353 | 1 | 0 |
| MSESELENOMETHIONINE | S - 354 | 1 | 0 |
| MSESELENOMETHIONINE | L - 355 | 0 | 1 |
| MSESELENOMETHIONINE | D - 356 | 0 | 1 |
| MSESELENOMETHIONINE | A - 357 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|