|
|
|
|
|
|
|
| Information on 1p0k_A_276 |
|
Loop code: 1p0k_A_276 PDB: 1p0k Chain: A Type: EH beta-alpha |
Loop Start: 276 Loop Length: 1 Sec Struct Nt length: 4 Sec Struct Ct length: 33 Structure geometry
|
| Sequence: | CTGMAGHFLKALTDSGEEGLLEEIQLILEELKLIMTVL |
| Sec Struct: | EEEE-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | G - 278 | 0 | 1 |
| PO4PHOSPHATE ION | M - 279 | 0 | 1 |
| PO4PHOSPHATE ION | A - 280 | 0 | 1 |
| PO4PHOSPHATE ION | G - 281 | 0 | 1 |
| PO4PHOSPHATE ION | H - 282 | 1 | 0 |
| PO4PHOSPHATE ION | L - 284 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|