|
|
|
|
|
|
|
| Information on 1pq3_A_246 |
|
Loop code: 1pq3_A_246 PDB: 1pq3 Chain: A Type: EH beta-alpha |
Loop Start: 246 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | IHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIH |
| Sec Struct: | EEEEEEGGGB-TTT--SBSS--SS-B-HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MNMANGANESE (II) ION | D - 251 | 0 | 1 |
| S2CS-2-(BORONOETHYL)-L-CYSTEINE | D - 251 | 0 | 1 |
| MNMANGANESE (II) ION | D - 253 | 0 | 1 |
| S2CS-2-(BORONOETHYL)-L-CYSTEINE | D - 253 | 0 | 1 |
| MNMANGANESE (II) ION | A - 254 | 0 | 1 |
| S2CS-2-(BORONOETHYL)-L-CYSTEINE | T - 263 | 0 | 1 |
| MNMANGANESE (II) ION | T - 265 | 0 | 1 |
| S2CS-2-(BORONOETHYL)-L-CYSTEINE | T - 265 | 0 | 1 |
| Associated ArchDB-EC Subclass to 1pq3_A_246 |
| For any comment or web-related incidence, send an email to the webmaster. |
|