|
|
|
|
|
|
|
| Information on 7a3h_A_132 |
|
Loop code: 7a3h_A_132 PDB: 7a3h Chain: A Type: EH beta-alpha |
Loop Start: 132 Loop Length: 15 Sec Struct Nt length: 4 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | VIYEIANEPNGSDVTWGNQIKPYAEEVIPIIR |
| Sec Struct: | EEEE--S---STT--TTTTHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| EOHETHANOL | T - 146 | 0 | 1 |
| EOHETHANOL | W - 147 | 0 | 1 |
| EOHETHANOL | G - 148 | 0 | 1 |
| EOHETHANOL | N - 149 | 0 | 1 |
| GOLGLYCEROL | K - 152 | 1 | 0 |
| GOLGLYCEROL | E - 156 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| ACI - CATALYTIC ACID/BASE | E - 139 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|