|
|
|
|
|
|
|
| Information on 1gve_B_189 |
|
Loop code: 1gve_B_189 PDB: 1gve Chain: B Type: EH beta-alpha |
Loop Start: 189 Loop Length: 18 Sec Struct Nt length: 5 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | RFYAFNPLAGGLLTGRYKYQDWKEEHFNGIALVEKALKTTY |
| Sec Struct: | EEEEE-TTGGGGGGT--------HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 189 | 1 | 0 |
| GOLGLYCEROL | F - 190 | 1 | 0 |
| GOLGLYCEROL | Y - 191 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC8 - GOL BINDING SITE FOR CHAIN B | R - 189 | 1 | 0 |
| AC8 - GOL BINDING SITE FOR CHAIN B | Y - 191 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|