|
|
|
|
|
|
|
| Information on 1p9s_A_171 |
|
Loop code: 1p9s_A_171 PDB: 1p9s Chain: A Type: EH beta-alpha |
Loop Start: 171 Loop Length: 25 Sec Struct Nt length: 2 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | HVGSSFDGVYGGFEDQPNLQVESANQLTVNVVAFLYAAIL |
| Sec Struct: | EE---TT---TT--SSSS---------HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | V - 172 | 0 | 1 |
| MSESELENOMETHIONINE | G - 173 | 0 | 1 |
| MSESELENOMETHIONINE | S - 174 | 0 | 1 |
| MSESELENOMETHIONINE | S - 175 | 0 | 1 |
| MSESELENOMETHIONINE | F - 176 | 0 | 1 |
| MSESELENOMETHIONINE | G - 178 | 0 | 1 |
| MSESELENOMETHIONINE | V - 179 | 0 | 1 |
| MSESELENOMETHIONINE | G - 182 | 0 | 1 |
| MSESELENOMETHIONINE | V - 201 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|