|
|
|
|
|
|
|
| Information on 1j9q_A_14 |
|
Loop code: 1j9q_A_14 PDB: 1j9q Chain: A Type: HA beta-beta hairpin |
Loop Start: 14 Loop Length: 21 Sec Struct Nt length: 3 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | RQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIV |
| Sec Struct: | EEE-----TTS-----SS--SS--EEEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CUCOPPER (II) ION | I - 45 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|