|
|
|
|
|
|
|
| Information on 1hxs_1_154 |
|
Loop code: 1hxs_1_154 PDB: 1hxs Chain: 1 Type: HA beta-beta hairpin |
Loop Start: 154 Loop Length: 21 Sec Struct Nt length: 7 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | VYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYT |
| Sec Struct: | EEEEEEE-TTS---SSTTSGGGG-SSS-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PLMPALMITIC ACID | I - 157 | 1 | 0 |
| PLMPALMITIC ACID | M - 158 | 1 | 0 |
| PLMPALMITIC ACID | Y - 159 | 0 | 1 |
| PLMPALMITIC ACID | P - 181 | 0 | 1 |
| PLMPALMITIC ACID | S - 182 | 0 | 1 |
| PLMPALMITIC ACID | I - 183 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|