|
|
|
|
|
|
|
| Information on 1hxs_1_205 |
|
Loop code: 1hxs_1_205 PDB: 1hxs Chain: 1 Type: AR beta-beta link |
Loop Start: 205 Loop Length: 32 Sec Struct Nt length: 2 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | YSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRV |
| Sec Struct: | EES---S-S----TTS-TTTT---TT--GGG---EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PLMPALMITIC ACID | Y - 205 | 0 | 1 |
| PLMPALMITIC ACID | S - 206 | 0 | 1 |
| PLMPALMITIC ACID | H - 207 | 0 | 1 |
| PLMPALMITIC ACID | L - 234 | 0 | 1 |
| PLMPALMITIC ACID | N - 235 | 0 | 1 |
| PLMPALMITIC ACID | F - 237 | 0 | 1 |
| PLMPALMITIC ACID | L - 240 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|