|
|
|
|
|
|
|
| Information on 1mpx_A_587 |
|
Loop code: 1mpx_A_587 PDB: 1mpx Chain: A Type: AR beta-beta link |
Loop Start: 587 Loop Length: 28 Sec Struct Nt length: 3 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | QVQSSLFPLYDRNPQTYVPNIFFAKPGDYQKATQRVY |
| Sec Struct: | EEES--BTTB----SS--S-GGG--GGG---EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | Q - 587 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 587 | 1 | 0 |
| GOLGLYCEROL | R - 598 | 0 | 1 |
| GOLGLYCEROL | P - 612 | 0 | 1 |
| GOLGLYCEROL | Y - 615 | 0 | 1 |
| GOLGLYCEROL | Q - 616 | 0 | 1 |
| GOLGLYCEROL | K - 617 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|