|
|
|
|
|
|
|
| Information on 3ovw_A_140 |
|
Loop code: 3ovw_A_140 PDB: 3ovw Chain: A Type: AR beta-beta link |
Loop Start: 140 Loop Length: 33 Sec Struct Nt length: 8 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | MNGALYLSEMPQDGGKSTSRNSKAGAYYGAGYCDAQCYVTPFI |
| Sec Struct: | EEEEEEEE---TTTTGGG-TT---TGGGT----BTT--B-SEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PCAPYROGLUTAMIC ACID | N - 160 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | S - 161 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | K - 162 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | A - 163 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | A - 169 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | F - 181 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|