|
|
|
|
|
|
|
| Information on 1gpi_A_138 |
|
Loop code: 1gpi_A_138 PDB: 1gpi Chain: A Type: AR beta-beta link |
Loop Start: 138 Loop Length: 34 Sec Struct Nt length: 7 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | NGALYLSAMDADGGMSKYPGNKAGAKYGTGYCDSQCPKDIKFI |
| Sec Struct: | EEEEEEE---TTTTTTT-TT--SGGGGT----BTT--S--SEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PCAPYROGLUTAMIC ACID | G - 157 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | N - 158 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | K - 159 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | A - 160 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | G - 161 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | T - 166 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | F - 179 | 0 | 1 |
| PCAPYROGLUTAMIC ACID | I - 180 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|