|
|
|
|
|
|
|
| Information on 1h1a_A_60 |
|
Loop code: 1h1a_A_60 PDB: 1h1a Chain: A Type: HA beta-beta hairpin |
Loop Start: 60 Loop Length: 3 Sec Struct Nt length: 23 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | VINYTADYRPNGNSYLAVYGWTRNPLIEYYVVESF |
| Sec Struct: | EEEEEEEEEEEEEEEEEEEEEEETTTEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 78 | 1 | 0 |
| GOLGLYCEROL | W - 80 | 1 | 0 |
| GOLGLYCEROL | E - 87 | 1 | 0 |
| GOLGLYCEROL | Y - 89 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| S2A - SO4 BINDING SITE FOR CHAIN A | R - 68 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|