|
|
|
|
|
|
|
| Information on 1f7z_A_104 |
|
Loop code: 1f7z_A_104 PDB: 1f7z Chain: A Type: AR beta-beta link |
Loop Start: 104 Loop Length: 24 Sec Struct Nt length: 5 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | MLIKLSSPVKLNARVATVALPSSCAPAGTQCLISG |
| Sec Struct: | EEEEESS----SSSS---B--SS---TT-EEEEEE |
| Associated ArchDB95 Subclass to 1f7z_A_104 |
| Associated ArchDB-EC Subclass to 1f7z_A_104 |
| For any comment or web-related incidence, send an email to the webmaster. |
|