|
|
|
|
|
|
|
| Information on 1mum_A_111 |
|
Loop code: 1mum_A_111 PDB: 1mum Chain: A Type: EH beta-alpha |
Loop Start: 111 Loop Length: 18 Sec Struct Nt length: 5 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | GLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVD |
| Sec Struct: | EEEEE-B---SSTT--S---B--HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | E - 115 | 0 | 1 |
| MGMAGNESIUM ION | Q - 117 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|