Information on 1ekb_B_104 |
Loop code: 1ekb_B_104 PDB: 1ekb Chain: B Type: AR beta-beta link |
Loop Start: 104 Loop Length: 26 Sec Struct Nt length: 5 Sec Struct Ct length: 6 Structure geometry
|
Sequence: | AMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAG |
Sec Struct: | EEEEESS-----SS----B---TT----TT-EEEEEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
ZNZINC ION | H - 107 | 0 | 1 |
ZNZINC ION | K - 111 | 0 | 1 |
ZNZINC ION | E - 126 | 0 | 1 |
Associated ArchDB95 Subclass to 1ekb_B_104 |