ArchDB - Biological DataBase of Protein Loops

Information on 1nn6_A_106

Loop code: 1nn6_A_106
PDB: 1nn6
Chain: A
Type: AR beta-beta link

Loop Start: 106 Loop Length: 26
Sec Struct Nt length: 5 Sec Struct Ct length: 6
Structure geometry

d (Å): 32.164600

delta (°): 138.634399

theta (°): 36.864899

rho (°): 326.709106

Sequence:	MLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAG
Sec Struct:	EEEEESS-----SS-------S------TT-EEEEEE

Associated ArchDB95 Subclass to 1nn6_A_106

Associated ArchDB-EC Subclass to 1nn6_A_106