|
|
|
|
|
|
|
| Information on 1qs8_A_40 |
|
Loop code: 1qs8_A_40 PDB: 1qs8 Chain: A Type: AR beta-beta link |
Loop Start: 40 Loop Length: 23 Sec Struct Nt length: 4 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | LWVPSKKCNSSGCSIKNLYDSSKSKSYEKDGTKVDITY |
| Sec Struct: | EEEEBTT---GGGGGS--B-GGG-TT-EEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACTACETATE ION | K - 46 | 0 | 1 |
| ACTACETATE ION | S - 60 | 0 | 1 |
| ACTACETATE ION | Y - 66 | 0 | 1 |
| ACTACETATE ION | K - 68 | 1 | 0 |
| STASTATINE | I - 75 | 1 | 0 |
| STASTATINE | T - 76 | 1 | 0 |
| STASTATINE | Y - 77 | 1 | 0 |
| Associated ArchDB95 Subclass to 1qs8_A_40 |
| For any comment or web-related incidence, send an email to the webmaster. |
|