Information on 1h0p_A_85 |
Loop code: 1h0p_A_85 PDB: 1h0p Chain: A Type: AR beta-beta link |
Loop Start: 85 Loop Length: 32 Sec Struct Nt length: 4 Sec Struct Ct length: 4 Structure geometry
|
Sequence: | MIQGGDFTRGDGTGGRSIYGEKFADENFKLKHYGAGWLSM |
Sec Struct: | EEEE--TTTSSSS---BTTBS-B------S---STTEEEE |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | M - 85 | 1 | 0 |
DTT2,3-DIHYDROXY-1,4-DITHIOBUTANE | Q - 87 | 0 | 1 |
Associated ArchDB95 Subclass to 1h0p_A_85 |
Associated ArchDB-EC Subclass to 1h0p_A_85 |