ArchDB - Biological DataBase of Protein Loops

Information on 1ist_A_59

Loop code: 1ist_A_59
PDB: 1ist
Chain: A
Type: AR beta-beta link

Loop Start: 59 Loop Length: 32
Sec Struct Nt length: 4 Sec Struct Ct length: 4
Structure geometry

d (Å): 12.880400

delta (°): 131.056793

theta (°): 40.492199

rho (°): 199.113907

Sequence:	MLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSM
Sec Struct:	EEEE--TTTSSSS----TTSS-B------S---SSSEEEE

Associated ArchDB95 Subclass to 1ist_A_59

Associated ArchDB-EC Subclass to 1ist_A_59