|
|
|
|
|
|
|
| Information on 1jz7_A_484 |
|
Loop code: 1jz7_A_484 PDB: 1jz7 Chain: A Type: EH beta-alpha |
Loop Start: 484 Loop Length: 34 Sec Struct Nt length: 2 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | VQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWL |
| Sec Struct: | EE--TTTSSSTT-SSB--BS--SS--B--SSS-B--HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GALD-GALACTOSE | M - 502 | 0 | 1 |
| GALD-GALACTOSE | Y - 503 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | R - 505 | 0 | 1 |
| DMSDIMETHYL SULFOXIDE | E - 508 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|