|
|
|
|
|
|
|
| Information on 2ngr_A_49 |
|
Loop code: 2ngr_A_49 PDB: 2ngr Chain: A Type: AR beta-beta link |
Loop Start: 49 Loop Length: 18 Sec Struct Nt length: 10 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | EPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFS |
| Sec Struct: | EEEEEEEEEE--SGGGTTTGGGG-TT-SEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| AF3ALUMINUM FLUORIDE | D - 57 | 0 | 1 |
| GDPGUANOSINE-5'-DIPHOSPHATE | D - 57 | 0 | 1 |
| MGMAGNESIUM ION | D - 57 | 0 | 1 |
| AF3ALUMINUM FLUORIDE | T - 58 | 0 | 1 |
| GDPGUANOSINE-5'-DIPHOSPHATE | T - 58 | 0 | 1 |
| MGMAGNESIUM ION | T - 58 | 0 | 1 |
| AF3ALUMINUM FLUORIDE | A - 59 | 0 | 1 |
| AF3ALUMINUM FLUORIDE | G - 60 | 0 | 1 |
| GDPGUANOSINE-5'-DIPHOSPHATE | G - 60 | 0 | 1 |
| AF3ALUMINUM FLUORIDE | Q - 61 | 0 | 1 |
| GDPGUANOSINE-5'-DIPHOSPHATE | Q - 61 | 0 | 1 |
| Associated ArchDB95 Subclass to 2ngr_A_49 |
| For any comment or web-related incidence, send an email to the webmaster. |
|