|
|
|
|
|
|
|
| Information on 1k4y_A_47 |
|
Loop code: 1k4y_A_47 PDB: 1k4y Chain: A Type: AR beta-beta link |
Loop Start: 47 Loop Length: 23 Sec Struct Nt length: 8 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | VAVFLGVPFAKPPLGSLRFAPPQPAESWSHVKN |
| Sec Struct: | EEEEEEEESS----GGGTTS--------SS-EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NAGN-ACETYL-D-GLUCOSAMINE | N - 79 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|