|
|
|
|
|
|
|
| Information on 1lkd_A_113 |
|
Loop code: 1lkd_A_113 PDB: 1lkd Chain: A Type: AR beta-beta link |
Loop Start: 113 Loop Length: 27 Sec Struct Nt length: 6 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | PLEIYYGASEVFEKPFLPGAAVSGFLTGEQGLGHFVRC |
| Sec Struct: | EEEEEE---B-TTS----SSS-S-B--GGG-S-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| BP62',6'-DICHLORO-BIPHENYL-2,6-DIOL | H - 146 | 0 | 1 |
| FE2FE (II) ION | H - 146 | 0 | 1 |
| BP62',6'-DICHLORO-BIPHENYL-2,6-DIOL | V - 148 | 1 | 0 |
| FE2FE (II) ION | V - 148 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|