|
|
|
|
|
|
|
| Information on 1qhw_A_256 |
|
Loop code: 1qhw_A_256 PDB: 1qhw Chain: A Type: AR beta-beta link |
Loop Start: 256 Loop Length: 20 Sec Struct Nt length: 5 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | GYVLSGAGNFMDPSVRHQRKVPNGYLRFHY |
| Sec Struct: | EEEEE--SS------TTGGGS-TT-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| FEFE (III) ION | G - 261 | 0 | 1 |
| FEFE (III) ION | F - 265 | 0 | 1 |
| ZNZINC ION | V - 270 | 0 | 1 |
| ZNZINC ION | L - 281 | 0 | 1 |
| ZNZINC ION | H - 284 | 1 | 0 |
| ZNZINC ION | Y - 285 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|