|
|
|
|
|
|
|
| Information on 1fvu_A_66 |
|
Loop code: 1fvu_A_66 PDB: 1fvu Chain: A Type: HA beta-beta hairpin |
Loop Start: 66 Loop Length: 30 Sec Struct Nt length: 7 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | YAWIGLRVENKEKQCSSEWSDGSSVSYENVVERTVKKCFALE |
| Sec Struct: | EEEEEEE---SSSSS--B-TTS-B-------GGG---EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | D - 86 | 0 | 1 |
| MGMAGNESIUM ION | S - 88 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|