|
|
|
|
|
|
|
| Information on 1ukm_A_67 |
|
Loop code: 1ukm_A_67 PDB: 1ukm Chain: A Type: HA beta-beta hairpin |
Loop Start: 67 Loop Length: 30 Sec Struct Nt length: 7 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | YVWIGLRDRREEQQCNPEWNDGSKIIYVNWKEGESKMCQGLT |
| Sec Struct: | EEEEEEE---SSS-S--B-TTS-B-------TT----EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CRYPROPANE-1,2,3-TRIOL | Y - 67 | 1 | 0 |
| CRYPROPANE-1,2,3-TRIOL | R - 76 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | E - 78 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | Q - 79 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | Q - 80 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | C - 81 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | N - 82 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | P - 83 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | E - 84 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | I - 91 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | I - 92 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | K - 97 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | E - 100 | 0 | 1 |
| CRYPROPANE-1,2,3-TRIOL | K - 102 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|