|
|
|
|
|
|
|
| Information on 1qlp_A_331 |
|
Loop code: 1qlp_A_331 PDB: 1qlp Chain: A Type: AR beta-beta link |
Loop Start: 331 Loop Length: 22 Sec Struct Nt length: 10 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | KAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVK |
| Sec Struct: | EEEEEEEEEE-S-SSSS----------SS---EEE |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| ACT - ACTIVE SITE RESIDUES. MET 382 --- SER 383 REACTIVE BOND | M - 358 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|