|
|
|
|
|
|
|
| Information on 1e3d_B_327 |
|
Loop code: 1e3d_B_327 PDB: 1e3d Chain: B Type: HA beta-beta hairpin |
Loop Start: 327 Loop Length: 35 Sec Struct Nt length: 4 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | IEEHVRHSWYEGKARAPFEGETNPHFTFMGDTDKYSWNKAPRY |
| Sec Struct: | EEEE-TTBTB-S--B-GGG----B----TT-SSS-BSS-EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | E - 329 | 0 | 1 |
| MGMAGNESIUM ION | T - 348 | 0 | 1 |
| MGMAGNESIUM ION | K - 365 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|