Information on 1nml_A_243 |
Loop code: 1nml_A_243 PDB: 1nml Chain: A Type: EH beta-alpha |
Loop Start: 243 Loop Length: 21 Sec Struct Nt length: 4 Sec Struct Ct length: 7 Structure geometry
|
Sequence: | YVFRASPLRNIELTAPYFHSGAVWSLEEAVAV |
Sec Struct: | EEEE----TTGGG--SBTTT--B--HHHHHHH |
PDB ligands within a cut-off distance of 6 Å in this loop |
Associated ArchDB95 Subclass to 1nml_A_243 |