|
|
|
|
|
|
|
| Information on 1lk2_A_46 |
|
Loop code: 1lk2_A_46 PDB: 1lk2 Chain: A Type: EH beta-alpha |
Loop Start: 46 Loop Length: 9 Sec Struct Nt length: 2 Sec Struct Ct length: 28 Structure geometry
|
| Sequence: | EPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGY |
| Sec Struct: | EE-SGGGGGS-HHHHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MPD2-METHYL-2,4-PENTANEDIOL | P - 47 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | R - 48 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | A - 49 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | R - 50 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | M - 52 | 0 | 1 |
| MPD2-METHYL-2,4-PENTANEDIOL | E - 53 | 0 | 1 |
| FUCFUCOSE | Q - 54 | 0 | 1 |
| Associated ArchDB95 Subclass to 1lk2_A_46 |
| For any comment or web-related incidence, send an email to the webmaster. |
|