|
|
|
|
|
|
|
| Information on 1kcl_A_355 |
|
Loop code: 1kcl_A_355 PDB: 1kcl Chain: A Type: EH beta-alpha |
Loop Start: 355 Loop Length: 26 Sec Struct Nt length: 5 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | VPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKL |
| Sec Struct: | EEEEETTGGGT----STTTT--------S-SHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GLCGLUCOSE | D - 371 | 0 | 1 |
| GLCGLUCOSE | R - 375 | 0 | 1 |
| Associated ArchDB95 Subclass to 1kcl_A_355 |
| For any comment or web-related incidence, send an email to the webmaster. |
|