|
|
|
|
|
|
|
| Information on 1nu6_A_540 |
|
Loop code: 1nu6_A_540 PDB: 1nu6 Chain: A Type: EH beta-alpha |
Loop Start: 540 Loop Length: 16 Sec Struct Nt length: 7 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | YPLLLDVYAGPCSQKADTVFRLNWATYLAS |
| Sec Struct: | EEEEEEE---TT----------SHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| HGMERCURY (II) ION | P - 550 | 0 | 1 |
| HGMERCURY (II) ION | C - 551 | 0 | 1 |
| HGMERCURY (II) ION | S - 552 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|