|
|
|
|
|
|
|
| Information on 1oep_A_29 |
|
Loop code: 1oep_A_29 PDB: 1oep Chain: A Type: EH beta-alpha |
Loop Start: 29 Loop Length: 26 Sec Struct Nt length: 6 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | GVFRSAVPSGASVYEACELRDGDKKRYVGKGCLQAVKNVNE |
| Sec Struct: | EEEEEE--B-----S--------TTSGGGT--HHHHHHHHH |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC4 - EDO BINDING SITE FOR CHAIN A | R - 32 | 1 | 0 |
| AC3 - SO4 BINDING SITE FOR CHAIN A | G - 38 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|