|
|
|
|
|
|
|
| Information on 1p42_A_216 |
|
Loop code: 1p42_A_216 PDB: 1p42 Chain: A Type: EH beta-alpha |
Loop Start: 216 Loop Length: 15 Sec Struct Nt length: 3 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | LVLGKDKVYNPEGLRYENEPVRHKVFDLIGDL |
| Sec Struct: | EEE-SS-B-STT--SSTTHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MYRMYRISTIC ACID | V - 217 | 0 | 1 |
| MYRMYRISTIC ACID | Y - 224 | 0 | 1 |
| ZNZINC ION | H - 238 | 1 | 0 |
| MYRMYRISTIC ACID | K - 239 | 1 | 0 |
| ZNZINC ION | F - 241 | 1 | 0 |
| MYRMYRISTIC ACID | D - 242 | 1 | 0 |
| ZNZINC ION | D - 242 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|