|
|
|
|
|
|
|
| Information on 1umv_X_39 |
|
Loop code: 1umv_X_39 PDB: 1umv Chain: X Type: HE alpha-beta |
Loop Start: 39 Loop Length: 13 Sec Struct Nt length: 14 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | ATDRCCFVHDCCYGKVTGCNPKIDSYTYSKK |
| Sec Struct: | HHHHHHHHHHHHHHT--SS-TTT----EEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | C - 44 | 1 | 0 |
| CACALCIUM ION | F - 45 | 1 | 0 |
| CACALCIUM ION | D - 48 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC1CA BINDING SITE FOR CHAIN X | D - 48 | 1 | 0 |
| Associated ArchDB95 Subclass to 1umv_X_39 |
| For any comment or web-related incidence, send an email to the webmaster. |
|