|
|
|
|
|
|
|
| Information on 1mpx_A_313 |
|
Loop code: 1mpx_A_313 PDB: 1mpx Chain: A Type: HE alpha-beta |
Loop Start: 313 Loop Length: 27 Sec Struct Nt length: 7 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | GAIHSYAAEPRDKRNTLNYLVGPWRHSQVNYDGSAL |
| Sec Struct: | HHHHHHH--TT-TTSSS--B-----TTGGGS--SEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | G - 313 | 1 | 0 |
| MSESELENOMETHIONINE | G - 313 | 1 | 0 |
| MSESELENOMETHIONINE | A - 314 | 1 | 0 |
| MSESELENOMETHIONINE | I - 315 | 1 | 0 |
| MSESELENOMETHIONINE | H - 316 | 1 | 0 |
| CACALCIUM ION | S - 317 | 1 | 0 |
| MSESELENOMETHIONINE | S - 317 | 1 | 0 |
| CACALCIUM ION | Y - 318 | 0 | 1 |
| MSESELENOMETHIONINE | Y - 318 | 0 | 1 |
| CACALCIUM ION | A - 319 | 0 | 1 |
| MSESELENOMETHIONINE | A - 319 | 0 | 1 |
| CACALCIUM ION | A - 320 | 0 | 1 |
| MSESELENOMETHIONINE | A - 320 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|