|
|
|
|
|
|
|
| Information on 1vjt_A_225 |
|
Loop code: 1vjt_A_225 PDB: 1vjt Chain: A Type: HE alpha-beta |
Loop Start: 225 Loop Length: 25 Sec Struct Nt length: 10 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | YPLLDEWIEKKLPEWEPKNPWDTQSPAADYKFYGLPI |
| Sec Struct: | HHHHHHHHHHTGGG---SSTT---------TTT--EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Y - 225 | 1 | 0 |
| MSESELENOMETHIONINE | L - 228 | 1 | 0 |
| MSESELENOMETHIONINE | W - 231 | 1 | 0 |
| MSESELENOMETHIONINE | I - 232 | 1 | 0 |
| MSESELENOMETHIONINE | L - 236 | 0 | 1 |
| MSESELENOMETHIONINE | W - 239 | 0 | 1 |
| MSESELENOMETHIONINE | D - 246 | 0 | 1 |
| MSESELENOMETHIONINE | T - 247 | 0 | 1 |
| MSESELENOMETHIONINE | Q - 248 | 0 | 1 |
| MSESELENOMETHIONINE | A - 252 | 0 | 1 |
| MSESELENOMETHIONINE | Y - 257 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|