|
|
|
|
|
|
|
| Information on 1gxs_A_126 |
|
Loop code: 1gxs_A_126 PDB: 1gxs Chain: A Type: HE alpha-beta |
Loop Start: 126 Loop Length: 7 Sec Struct Nt length: 18 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | DDKMAQDTYTFLVKWFERFPHYNYREFYIAGE |
| Sec Struct: | HHHHHHHHHHHHHHHHHH-GGGTTSEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| BEZBENZOIC ACID | D - 126 | 1 | 0 |
| BEZBENZOIC ACID | E - 157 | 1 | 0 |
| DKADECANOIC ACID | E - 157 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| BZ1 - BEZ BINDING SITE FOR DIMER AB | D - 126 | 1 | 0 |
| DK1 - DKA BINDING SITE FOR DIMER AB | E - 157 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|