|
|
|
|
|
|
|
| Information on 1hjx_A_147 |
|
Loop code: 1hjx_A_147 PDB: 1hjx Chain: A Type: HE alpha-beta |
Loop Start: 147 Loop Length: 7 Sec Struct Nt length: 19 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | KQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALS |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHTTT----EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | K - 147 | 1 | 0 |
| GOLGLYCEROL | L - 178 | 1 | 0 |
| GOLGLYCEROL | S - 179 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| CC5 - GOL BINDING SITE FOR CHAIN A | K - 147 | 1 | 0 |
| BC8 - GOL BINDING SITE FOR CHAIN A | S - 179 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|