|
|
|
|
|
|
|
| Information on 1a81_A_105 |
|
Loop code: 1a81_A_105 PDB: 1a81 Chain: A Type: EH beta-alpha |
Loop Start: 105 Loop Length: 14 Sec Struct Nt length: 2 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | KPFNRPQGVQPKTGPFEDLKENLIREYVKQT |
| Sec Struct: | EE----SS------SSHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PTRO-PHOSPHOTYROSINE | R - 129 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|