|
|
|
|
|
|
|
| Information on 1ru3_A_304 |
|
Loop code: 1ru3_A_304 PDB: 1ru3 Chain: A Type: HE alpha-beta |
Loop Start: 304 Loop Length: 28 Sec Struct Nt length: 9 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | IVQTALEVRGIKITSIDIDLPINFGPAFEGESIRKGDMHVEFG |
| Sec Struct: | HHHHHHHHHT----------SS-BSGGGTT----TTTEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | P - 329 | 0 | 1 |
| GOLGLYCEROL | A - 330 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|