|
|
|
|
|
|
|
| Information on 1cpc_A_21 |
|
Loop code: 1cpc_A_21 PDB: 1cpc Chain: A Type: HH alpha-alpha |
Loop Start: 21 Loop Length: 1 Sec Struct Nt length: 26 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | STEIQTAFGRFRQASASLAAAKALTEKASSLASGAANAVYSK |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CYCPHYCOCYANOBILIN | S - 21 | 1 | 0 |
| CYCPHYCOCYANOBILIN | I - 24 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Q - 25 | 1 | 0 |
| CYCPHYCOCYANOBILIN | F - 28 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Q - 33 | 1 | 0 |
| CYCPHYCOCYANOBILIN | A - 36 | 1 | 0 |
| CYCPHYCOCYANOBILIN | A - 56 | 1 | 0 |
| CYCPHYCOCYANOBILIN | V - 59 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Y - 60 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|