|
|
|
|
|
|
|
| Information on 1gh0_A_4 |
|
Loop code: 1gh0_A_4 PDB: 1gh0 Chain: A Type: HH alpha-alpha |
Loop Start: 4 Loop Length: 6 Sec Struct Nt length: 11 Sec Struct Ct length: 26 Structure geometry
|
| Sequence: | PLTEAVSVADSQGRFLSSTEIQVAFGRFRQAKAGLEAAKALTS |
| Sec Struct: | HHHHHHHHHHHTT----HHHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CYCPHYCOCYANOBILIN | S - 21 | 0 | 1 |
| CYCPHYCOCYANOBILIN | I - 24 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Q - 25 | 1 | 0 |
| CYCPHYCOCYANOBILIN | F - 28 | 1 | 0 |
| CYCPHYCOCYANOBILIN | R - 32 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Q - 33 | 1 | 0 |
| CYCPHYCOCYANOBILIN | A - 36 | 1 | 0 |
| Associated ArchDB95 Subclass to 1gh0_A_4 |
| For any comment or web-related incidence, send an email to the webmaster. |
|