|
|
|
|
|
|
|
| Information on 1gh0_A_126 |
|
Loop code: 1gh0_A_126 PDB: 1gh0 Chain: A Type: HH alpha-alpha |
Loop Start: 126 Loop Length: 4 Sec Struct Nt length: 14 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | PSWYIEALKYIKANHGLSGDAAVEANSYLDYAINA |
| Sec Struct: | HHHHHHHHHHHHHHS---HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CYCPHYCOCYANOBILIN | W - 128 | 1 | 0 |
| CYCPHYCOCYANOBILIN | Y - 129 | 1 | 0 |
| CYCPHYCOCYANOBILIN | A - 132 | 1 | 0 |
| CYCPHYCOCYANOBILIN | G - 144 | 0 | 1 |
| CYCPHYCOCYANOBILIN | D - 145 | 1 | 0 |
| CYCPHYCOCYANOBILIN | A - 146 | 1 | 0 |
| CYCPHYCOCYANOBILIN | V - 148 | 1 | 0 |
| CYCPHYCOCYANOBILIN | E - 149 | 1 | 0 |
| CYCPHYCOCYANOBILIN | S - 152 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|