|
|
|
|
|
|
|
| Information on 1g5n_A_245 |
|
Loop code: 1g5n_A_245 PDB: 1g5n Chain: A Type: HH alpha-alpha |
Loop Start: 245 Loop Length: 9 Sec Struct Nt length: 10 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | IPAYLAETLYYAMKGAGTDDHTLIRVIVSR |
| Sec Struct: | HHHHHHHHHHTTS-SSS--HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SGNN,O6-DISULFO-GLUCOSAMINE | P - 246 | 1 | 0 |
| CACALCIUM ION | A - 256 | 0 | 1 |
| CACALCIUM ION | M - 257 | 0 | 1 |
| CACALCIUM ION | K - 258 | 0 | 1 |
| CACALCIUM ION | G - 259 | 0 | 1 |
| CACALCIUM ION | A - 260 | 0 | 1 |
| CACALCIUM ION | G - 261 | 0 | 1 |
| CACALCIUM ION | T - 262 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|